PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004504397.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 242aa    MW: 27864.7 Da    PI: 8.6824
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004504397.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.81e-31959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  XP_004504397.1  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                    79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.515161IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.59E-34280IPR002100Transcription factor, MADS-box
CDDcd002659.77E-45276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-33323IPR002100Transcription factor, MADS-box
PfamPF003192.2E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-333859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129715.73489185IPR002487Transcription factor, K-box
PfamPF014861.6E-2691172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSS  60
SSMLKTLERY QKCNYGAPET NVSTREALEL SSQQEYLKLK ARYEALQRSQ RNLMGEDLGP  120
LSSKELESLE RQLDTSLQQI RSTRTQFMLD QLSDLQRKEH MLSEANRSLR QRQLERYQLN  180
QLQMNHCVEE MGYGRHPSQT HGDGLFQQME CEPTLQIGYQ ADPGSVVAAG PSMSNYMAGW  240
LP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_D1e-46751721100Developmental protein SEPALLATA 3
4ox0_C1e-46751721100Developmental protein SEPALLATA 3
4ox0_B1e-46751721100Developmental protein SEPALLATA 3
4ox0_A1e-46751721100Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX3907180.0JX390718.1 Medicago polyceratia SEPALLATA3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004504397.11e-180PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform X1
SwissprotO658741e-147MTF1_PEA; MADS-box transcription factor 1
SwissprotQ034891e-147AGL9_PETHY; Agamous-like MADS-box protein AGL9 homolog
TrEMBLG7LHA31e-169G7LHA3_MEDTR; MADS-box transcription factor
STRINGGLYMA05G28140.31e-164(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22932178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.11e-125MIKC_MADS family protein